Fortlangleyvillagefarmersmarket.org

Fort Langley Village Farmers Market, fresh vegetables & fruit, flowers, baking, honey, jams, wines & craft beers. B.C. Arts & Crafts, soaps & jewelry, clothing, painters & woodcrafters.

Popularity: Safety: Legit: legal Contact info: Contact page

Fortlangleyvillagefarmersmarket.org Domain Statistics

Title:
Fort Langley Village Farmers Market
Description:
Fort Langley Village Farmers Market, fresh vegetables & fruit, flowers, baking, honey, jams, wines & craft beers. B.C. Arts & Crafts, soaps & jewelry,... more
SEO score:
25%
Website Worth:
$1,050 USD
Web Safety:
Web safety signals the level of trust for the site's suitability for all users.
Child Safety:
Child safety signals the level of trust for the site's suitability for children.
IP-address:
108.163.188.154 [Trace] [Reverse]
Pageviews per User:
1
Daily Pageviews:
n\a
Load Time:
0.18 seconds

Fortlangleyvillagefarmersmarket.org competitors

 

Clover Valley Farmers' Market | Fort Frances, Ontario...

The clover valley farmers' market (cvfm) has operated a successful farmers' market for over 22 years

| | www.clovervalleyfarmersmarket.ca

 

Wenatchee Valley Farmers Market | Fresh, Local, Fun Since 1979!

Farmers market

| | www.wenatcheefarmersmarket.com

 

Indy Local Food Guide

The indy local food guide is central indianas resource for sustainable food and agricultural from farm to table

| | www.indylocalfood.org

 

Yorkshire Farmers Market - Yorkshire Farmers Markets

Yorkshire farmers markets where people sell locally produced products - yorkshire farmers markets

| | www.yorkshirefarmersmarkets.co.uk

 

Local Farmers. Fresh Food. Great Community.

Mfm accepts credit cards & snap/ebt mfm can now accept snap benefits (formerly known as "food stamps")

| | montgomeryfarmersmarket.org

 

Farmers Market - Local Produce Fresh From Farmers in New Zealand...

Place to find out about farmers market - local produce fresh from farmers in new zealand

| | www.newzealandfarmersmarkets.co.nz

 

24 Years Serving The Everett Community

Sundays at the port of everett and fridays at the everett mall

| | www.everettfarmersmarket.com

 

Sonoma Valley Certified Farmers Market - Sonoma Valley Certified Farmers...

The sonoma valley certified farmers' market (svcfm) has been serving sonomans with certified produceand

| | www.svcfm.org

 

Home

Abundant fields farm is a petite farm located east of portland in the small community of orient, oregon

| | abundantfieldsfarm.com

 

Kernersville Farmers Market - Fresh Home Grown Agriculture, Local Farmers...

Kernersville farmers market - fresh home grown agriculture, local farmers & vendors

| | www.kernersvillefarmersmarket.com

Fortlangleyvillagefarmersmarket.org Sites with a similar domain name

We found 18 websites. With this list, you can understand how other people are using the domain, similar to yours.

 

The Children of Fort Langley

The descendants of the men who worked at fort langley british columbia and their wives

| | fortlangley.ca

 

Fort Langley Village | The Fort Shopping Directory bc Canada

Historic fort langley british columbia canada. Attractions in langley township in fraser valley bc, including attractions, shopping, dining, antiques, merchants, services, health, museums, menus and local merchant phone directory. Annual special events in

| | fortlangleyvillage.com

 

Fortlangleyguesthouse.com

Guest house - creating walker bed. Luxurious warm touch of white traditional kitchen. Extravagant small kitchen for simple home. Walker's beds. Walker bed shaper for sale. Pat walker bed. Walker bed and breakfast minnesota. Walker bedding high point

| | fortlangleyguesthouse.com

 

Fort Langley Canoe Club | Dragonboat, Kayak, Outrigger & Voyageur

Recreational & competitive teams youth & adult programs outrigger 6 & outrigger 1 year round paddling agm notice notice

| | fortlangleycanoeclub.ca

 

Realtor News

Small business web hosting offering additional business services such as: domain name registrations, email accounts, web services, frontpage help, online community resources and various small business solutions

| | fortlangleyrealtor.com

 

Fort Langley Massage Therapy And Holistic Health

Fort langley massage therapy and holistic health has 5 passionate and knowledgable therapists offering many therapies. Youre in good hands

| | fortlangleymassage.com

 

Domain Expired

Country fair bistro cafe & patio. Located in fort langley, bc, canada. Serving seattles best coffee in our licensed restaurant. All day breakfast and lunch. 40 seat restaurant

| | fortlangley.co

 

Fortlangleytours.com Latest Online Marketing News

Fortlangleytours.com latest online marketing news

| | fortlangleytours.com

 

Online Shops Outdoor Jackets, Indoorcourt Shoes, Outdoor Vests...

Cricket shoes,sweaters & hoodies,slippers,outdoor jackets,boating shoes top quality we support the purchase after the fast delivery!

| | fortlangleyartglass.com

 

Fort Langley Youth Rowing Society

The fort langley youth rowing society (flyrs) is a rowing club for high school students. We are a competitive team who practices on the bedford channel

| | fortlangleyyouthrowingsociety.ca

 

Fort Langley Artists Group - Home

Fort langley artists group, flag

| | fortlangleyartistsgroup.com

 

Fort Langley Veterinary Clinic - Fort Langley, bc - Home

Fort langley veterinary clinic | fort langley | bc | vet | pet clinic | veterinarian | veterinary | small animal | we are a full service animal hospital providing healthcare services to pets in fort langley and the surrounding areas. Our veterinarians off

| | fortlangleyvet.com

 

Langley Fort Lions

Community hall rentals for weddings, receptions, parties, meetings, film production-parking and events in fort langley bc, canada

| | fortlangleylionshall.com

Fortlangleyvillagefarmersmarket.org Contact information :

http://www.fortlangleyvillagefarmersmarket.org/?page_id=93 - Contact Us | Fort Langley Village Farmers' Market
Facebook profile for fortlangleyvillagefarmersmarket.org - Fort Langley Village Farmers Market - Langley (British Columbia) - Markt | Facebook
See fortlangleyvillagefarmersmarket.org contact information in whois record

Web Safety

fortlangleyvillagefarmersmarket.org is a safe website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.

Google Safebrowsing:
Avg Antivirus
Wot Raiting
SiteAdvisor
Child Safety

Fortlangleyvillagefarmersmarket.org Visitors Localization

Traffic Estimations Low
Traffic Rank 19,030,123th most visited website in the World

Website categories

Currently, we found 9 categories on fortlangleyvillagefarmersmarket.org
local 106'117 sites market 115'034 sites
farmers market 4'101 sites organics food 124 sites
vendor space 18 sites fruit 25'012 sites
Show more

Fortlangleyvillagefarmersmarket.org Top Keywords

This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.

Keyword Position Date
langley farm market
8 2016-01-23
dingley village craft \u0026 produce market
27 2015-12-07

Fortlangleyvillagefarmersmarket.org Websites hosted on same IP

 

Klr Consulting | Klr Home

Klr serves businesses across north america with project management planning, business consulting services, and management consulting

| | www.klr.com

 

Briefcase Moms :   Coaching Working Mothers to Live a Balanced Life...

Author and life coach, lisa martin, shares 10 powerful practices that have helped hundreds of working mothers achieve life and work balance

| | www.briefcasemoms.com

 

David Morrison - The Freelance Writer

Published writer and internet copywriter offering a comprehensive freelance writing service including website copy, ghostwriting, editing, proofreading and much more

| | www.thefreelancewriter.ca

 

Holistic Energy Healer in North Vancouver

Colleen wynia is a holistic energy healer in north vancouver. She will help you align your body and spirit through quantum energy using massage & bodywork, transformational coaching, spirit communication and nutrition

| | heartlinkconsulting.com

 

Welcome i Lindsay Chetek Design

| | www.lindsaychetek.com

 

Reel North Outfitters Inc.

We are a family based operation established in 2001. We all share the love of fishing and living in the north. With each year we have welcomed returning and new sportsman who share the same sentiment with us. We enjoy spending one on one time with our gro

| | www.reelnorthoutfitters.com

 

Dr.joti Samra, R.psych.- tv Psychologist, Media Psychologist, tv Host...

Organizational & media consultant

| | www.drjotisamra.com

Fortlangleyvillagefarmersmarket.org Website Load Time

Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-23, website load time was 0.18. The highest load time is 0.25, the lowest load time is 0.18, the average load time is 0.20.

Whois Lookup For fortlangleyvillagefarmersmarket.org

0reviews

Add review