Femiweb.com
FemiWeb est un site consacré à l'information médicale grand public dans les domaines de la gynécologie, la grossesse et l'accouchement, la pédiatrie et la psycho de l'enfant.
Femiweb.com Domain Statistics
![Femiweb.com visits more people from France](/img/flags/fr.png)
![](/ads/a3.jpg)
![](/ads/a1.jpg)
Femiweb.com Sites with a similar domain name
We found 15 websites. With this list, you can understand how other people are using the domain, similar to yours.
Olyan, Mint Te!
Női tartalmak és szolgáltatások egy helyen: frizurapróba, horoszkópok, jósprogramok, diéták, edzéstervek, receptek, szépségápolás, egészség, ké
|
|
femina.hu
Women's Magazine - Fashion, Beauty, Relationships, Health | Femina...
Femina magazine is a platform for women to get latest info and tips on fashion beauty health and relationship advice. Subscribe to indias no.1 womens magazine
|
|
femina.in
Feminin Bio, le Site Bio Qui Change la Vie Des Femmes
Feminin bio, le site du bien-être et du bien vivre vous propose des conseils et astuces pour mieux vivre bio et lécologie au quotidien
|
|
femininbio.com
Femina - Magazín, Který Ženám Rozumí
Magazín, který ženám rozumí
|
|
femina.cz
Conseils Beauté et Idées de Décoration, Toutes Vos Passions Sur...
Conseils de coupes de cheveux, astuces bien-être, psychologie et sexualité, idées de décoration, recettes gourmandes à tester, culture et vie quotidienne. Version femina, le site de la femme moderne!
|
|
femina.fr
Femina | Home
Femina, majalah wanita modern indonesia terlengkap, aktual dan inspiratif. Informasi terkini tentang dunia wanita, relationship,trend mode, rambut dan kecantikan, resep, kuliner lokal dan mancanegara, wirusaha, karier, kesehatan, travel dan rumah
|
|
femina.co.id
Www.femininehygienedeals.co.cc • Buy or Donate on Instagram
|
|
femininehygienedeals.co.cc
Www.femininehygienensanitarynapkins.co.cc • Buy or Donate on Instagram...
|
|
femininehygienensanitarynapkins.co.cc
Www.femininehygiene-nstore.co.cc • Buy or Donate on Instagram
|
|
femininehygiene-nstore.co.cc
Your Best Wellness Tips | Keep Healthy
|
|
femiwellnesstips.com
Femiweld.com
|
|
femiweld.com
Multi-gyn
Multi-gyn : medisch hulpmiddelen die vaginale ongemakken voorkomen en behandelen
|
|
femiwash.com
Femiwilliams-company.com
Femiwilliams-company.com
|
|
femiwilliams-company.com
Welcome Femiworld.com - Justhost.com
Web hosting from just host. Professional web hosting services with free domain name, unlimited web hosting space and unlimited bandwidth
|
|
femiworld.com
— Coming Soon
|
|
femiwrites.com
Femiweb.com Domain Info
Domain Name: | femiweb.com |
Registrar: | Easyspace Ltd |
Domain Age: | 16 years and 2 months |
See femiweb.com whois information |
Femiweb.com subdomains
We found 1 subdomains for this website.
Femiweb - un Site Consacré à L'information Médicale Grand Public Dans...
Un site consacré à l'information médicale grand public dans les domaines de la gynécologie, la grossesse et l'accouchement, la pédiatrie et la psycho de l'enfant
|
|
local.femiweb.com
Femiweb.com Contact information :
![]() |
![]() |
See femiweb.com contact information in whois record |
Web Safety
femiweb.com is
website. This information is from Google, AVG Threat Labs, McAfee SiteAdvisor, Wot.
|
|
---|---|
|
![](/ads/a3.jpg)
Is Femiweb.com Legal or Not
URLs Requested to be Removed: | 0 |
---|---|
Urls removed: | 0 |
Percent: | 0% |
Summary: | Femiweb.com is a legal, because it is not contained in the list of sites - https://transparencyreport.google.com/copyright/domains/ |
Femiweb.com Visitors Localization
Traffic Estimations | |
---|---|
Traffic Rank | 2,034,095th most visited website in the World |
![]() |
52.9 | ![]() |
8 |
Website categories
mode 57'113 sites |
Femiweb.com Top Keywords
This report shows links that we found on other domains than the index page. You can use this list of domains in order to understand what content users like.
Keyword | Position | Date |
---|---|---|
grossesse precautions alimentaires | 6 | 2016-01-14 |
femme qui allaite | 7 | 2015-12-09 |
pertes marrons | 11 | 2015-12-08 |
pilule quest | 18 | 2015-12-15 |
definition of hormonal contraception | 19 | 2015-12-01 |
calendrier echographie | 20 | 2015-12-11 |
colposcopie et biopsie | 21 | 2015-12-06 |
grippe et grossesse | 25 | 2015-12-09 |
chat femme enceinte | 29 | 2016-02-04 |
Femiweb.com Backlinks History
At the last check on 2018-08-17, we found 2 backlinks. The highest value is 2, the lowest value is 2, the average is 2.
Femiweb.com Websites hosted on same IP
Quelle Salle de Sport - Quel Est la Meilleure Salle de Sport Près...
Trouvez la meilleur salle de sport près de chez vous
|
|
quelle-salle-sport.com
Rue Des Avis - Découvrez Les Meilleurs Commerçants de Votre Quartier...
Avis et réductions sur les commerçants de votre quartier
|
|
www.rue-des-avis.com
Voisineo - Communauté de Quartier
Voisineo est un lieu de rencontre local avec vos voisins, votre quartier, vos commerces de proximité
|
|
www.voisineo.com
Quel Plombier - Quel Est le Meilleur Plombier Près de Chez Moi
Trouvez le meilleur plombier près de chez vous
|
|
quel-plombier.com
Quel Electricien - Quel Est le Meilleur Electricien Près de Chez Moi...
Trouvez le meilleur electricien près de chez vous
|
|
www.quel-electricien.com
Quel Coiffeur - Quel Est le Meilleur Coiffeur Près de Chez Moi
Trouvez le meilleur coiffeur près de chez vous
|
|
www.quel-coiffeur.com
Quel Photographe - Quel Est le Meilleur Photographe Près de Chez Moi...
Trouvez rapidement le meilleur photographe près de chez vous
|
|
www.quel-photographe.com
Quel Déménageur - Quel Est le Meilleur Déménageur Près de Chez Moi...
Trouvez rapidement le meilleur déménageur près de chez vous
|
|
www.quel-demenageur.com
Coupons Reduc- Bons de Réductions Dans Votre Ville
Coupons reduc vous propose des coupons de réduction près de chez vous
|
|
www.coupons-reduc.fr
Annuaire Dentiste
|
|
annuaire-dentiste.com
Femiweb.com Website Load Time
Website load time is an important factor, because Google is taking the site’s loading speed into consideration in determining its ranking. Even though this will not have a big impact, it is still something we (webmasters) should really look into. The reason is pretty simple – the majority of visitors are usually in a rush and no one is fond of waiting half a century before the website finally loads its content or fails to load. At the last check on 2016-08-31, website load time was 1.07. The highest load time is 3.34, the lowest load time is 1.07, the average load time is 2.77.